_how-to-effectively-read-food-labels.jpg "How to Effectively Read Food Labels from what does steam mean in science Video Screenshot Preview")
GalleryPlay Video:
(Note: The default playback of the video is HD VERSION. If your browser is buffering the video slowly, please play the REGULAR MP4 VERSION or Open The Video below for better experience. Thank you!)
⏲ Duration: 1:30
👁 View: 14M times
✓ Published: 14-May-2024
👁 View: 14M times
✓ Published: 14-May-2024
Description:
How to Effectively Read, Food Labels.<br/>These tips offer helpful strategies for getting more mindful about what you eat on the daily.<br/>1, Understand why the <br/>food labels are there.<br/>Nutrition labels became mandatory in 1992 to give consumers the bare facts about their food purchases.<br/>2, Here are some recent <br/>changes to the food labels. .<br/>As our understanding of nutrition develops, <br/>so too has the nutrition label. The number of calories <br/>is currently front and center of food labels.<br/>3, Here's what to look for.<br/>The number of calories, serving size, nutrients and percent daily value are all helpful guides to help you decide what you buy and how much of it you'll eat.<br/>3, Here's what those things mean.<br/>The nutrients include the fat, protein, <br/>carb and sodium content. The percent daily value <br/>is how much of these are recommended daily.<br/>5, Keep these targets in mind.<br/>The daily recommended maximum <br/>for saturated fat is 20 grams, .<br/>sodium is 2,300 mg, .<br/>added sugar is between <br/>25 and 36 grams ...<br/>... and trans fat is zero grams.<br/>6, Remember these final tips.<br/>The total fat count isn't as important <br/>as the types of fat listed, .<br/>not all carbs are the same <br/>so pay attention to the added sugar ...<br/>... and cholesterol continues <br/>to be controversial
How to Effectively Read, Food Labels.<br/>These tips offer helpful strategies for getting more mindful about what you eat on the daily.<br/>1, Understand why the <br/>food labels are there.<br/>Nutrition labels became mandatory in 1992 to give consumers the bare facts about their food purchases.<br/>2, Here are some recent <br/>changes to the food labels. .<br/>As our understanding of nutrition develops, <br/>so too has the nutrition label. The number of calories <br/>is currently front and center of food labels.<br/>3, Here's what to look for.<br/>The number of calories, serving size, nutrients and percent daily value are all helpful guides to help you decide what you buy and how much of it you'll eat.<br/>3, Here's what those things mean.<br/>The nutrients include the fat, protein, <br/>carb and sodium content. The percent daily value <br/>is how much of these are recommended daily.<br/>5, Keep these targets in mind.<br/>The daily recommended maximum <br/>for saturated fat is 20 grams, .<br/>sodium is 2,300 mg, .<br/>added sugar is between <br/>25 and 36 grams ...<br/>... and trans fat is zero grams.<br/>6, Remember these final tips.<br/>The total fat count isn't as important <br/>as the types of fat listed, .<br/>not all carbs are the same <br/>so pay attention to the added sugar ...<br/>... and cholesterol continues <br/>to be controversial
Share with your friends:
Whatsapp | Viber | Telegram | Line | SMS
Email | Twitter | Reddit | Tumblr | Pinterest
Related Videos
_rabbit-r1-review-somehow-worse.webp "The adorable, whimsical and a very orange Rabbit R1 is here and it left us wondering if these AI-powered gadgets are even possible. The most intriguing tech in the R1 is what Rabbit calls the “Large Action Model”. Where a large language model, or LLM, is all about analyzing and creating text, the LAM is supposed to be about doing stuff. But in our week-long testing, the R1 has consistently proven to be underwhelming, underpowered and undercooked.")
_badhaai-ho-movie---ayushmann-khurrana-sanya-malhotra-neena-gupta-and-gajraj-rao.webp "‘Badhaai Ho’ starring Ayushmann Khurrana, Sanya Malhotra, Gajraj Rao and Neena Gupta.<br/>Directed by: Amit Ravindernath Sharma<br/>Produced by: Vineet Jain, Aleya Sen, Hemant Bhandari, Amit Ravindernath Sharma<br/>Co-Producer: Priti Shahani<br/>Story: Shantanu Srivastava & Akshat Ghildial<br/>Story: (Junglee Pictures) Jyoti Kapoor<br/>Screenplay: Akshat Ghildial<br/>Director of Photography: Sanu John Verughese<br/>Production Designer: Ratheesh UK<br/>Lyrics: Vayu, MellowD, Kumaar<br/>Music: Tanishk Bagchi, Rochak Kohli, Kaushik-Akash-Guddu (Jam8), Sunny Bawra-Inder Bawra<br/>Badhaai Ho movie: Badhaai Ho doesn’t quite know what it wants us to do more, laugh or cry. And parts of the film sink into sitcom flatness, especially when Sikri overdoes her grumpy 'saas' act, though some of her lines are laugh-out-loud.<br/>Ayushmann Khurrana is now well-versed with the art of being humiliated. If it's set in Delhi like Vicky Donor, then he's even more at ease. But in Badhaai Ho in which he plays the eldest son, Nakul, who avoids public eye after he learns that his mother is expecting, Khurrana doesn't deliver the best embarrassed performance. That honour goes to Gajraj Rao as the caring husband to Priyamvada aka Bubbly (Neena Gupta) who has to break the news.<br/><br/>Rao, best known for being a regular on The Viral Fever sketches, never misses a beat as Jeetu Kaushik, the patriarch who finds himself negotiating the wrath of not only his mother (Surekha Sikri in badass mode) and his two sons but also the glares and gossip of relatives and neighbours.<br/><br/>Badhaai Ho works best when writer Akshat Ghildial sticks to capturing the myriad reactions - shock, amusement, anger and scorn - to an unplanned pregnancy in a couple least likely to. It's in the first half while capturing the minutiae of middle class life in the Kaushik household that the family comedy registers its finest moments.<br/><br/>")
_adorable-toddler-imitates-fourth-grade-aunt-writing-on-paper.webp "An adorable one-year-old girl imitated her fourth grade aunt who was writing in a notebook as she worked on a module. Despite having no clue what she was doing, the toddler tried her best to mimic her aunt. She scribbled on a piece of paper using a pen given to her by her family, periodically readjusting to get a better position.<br/><br/>The underlying music rights are not available for license. For use of the video with the track(s) contained therein, please contact the music publisher(s) or relevant rightsholder(s).")
_rating-swansea-city-and-cardiff-citys-2392-24-championship-campaigns.webp "As Cardiff City and Swansea City had quite similar seasons across the championship this campaign. A look at how their efforts were received and what they need to do to ensure a push on in the future and near return to glory with promotion back to the Premier League.")
_can-you-get-pregnant-on-your-period-ilana-glazer-and-michelle-buteau-debate.webp "</a><p>What would you do if you got pregnant after a one-night stand</a> - and learned later on that the person you'd slept with unexpectedly died? That's the dramatic conceit of \")
_detan-face-pack-hafte-me-kitni-bar-chehre-par-lagana-chahiye-124-boldsky.webp "डिटैन फेस पैक कब लगाएं: फेस पैक हम सभी लगाते हैं। ये स्किन की कई समस्याओं को दूर करने और चेहरे की चमक बरकरार रखने में मददगार है। लोग अपनी अलग-अलग स्किन के अनुसार, अलग-अलग प्रकार से फेस पैक का इस्तेमाल करते हैं। लेकिन, ज्यादातर लोग ये नहीं जानते कि डिटैन फेस पैक कब और कितने दिनों के अंतराल पर लगाना चाहिए। तो, आइए हम आपको बताते हैं इस बारे में। इस दौरान हम ये भी जानेंगे कि अपनी स्किन के अनुसार हम डिटैन फेस पैक का इस्तेमाल कर सकते हैं।<br/> <br/>When to apply face pack: We all apply face pack. It is helpful in removing many skin problems and maintaining the glow of the face. People use face packs in different ways according to their different skin types. But, most of the people do not know when and at what interval of how many days the face pack should be applied. So, let us tell you about this. During this, we will also know which face pack we can use according to our skin.Watch Detan Face Pack Hafte Me Kitni Bar Chehre Par Lagana Chahiye ? <br/> <br/>#detanfacepackkitnedinmelaganachahiye #detanfacepackhaftemekitnibarlagaye #detanfacepackforskintypes <br/><br/>~PR.111~ED.118~")
_free-stars-children-of-infinity-is-an-epic-space-action-rpg-and-the-long-awaited-sequel-to-the-ur-quan-masters.webp "❤️ More details: https://www.kickstarter.com/projects/pistolshrimp/free-stars-children-of-infinity/description<br/>⭐ Social media: https://freestarsgame.com/<br/>⭐ Social media: https://pistolshrimpgames.com/<br/>⚔️ Wishlist on Steam: https://store.steampowered.com/app/2853290/Free_Stars_Children_of_Infinity/<br/><br/>☕ Support me on Ko-Fi: https://ko-fi.com/extralife<br/><br/>Free Stars: Children of Infinity is an action-adventure game inspired by the golden age of science fiction, defined by its hopeful future, wondrous technology, and a grandiose galaxy filled with eclectic stories. <br/><br/>You are the captain of a mission to the farthest reaches of space, where you'll discover thousands of exotic worlds and dozens of alien denizens. Some are friendly, some are terrifying, and some are just plain weird. <br/><br/>It’s up to you to decide how to acquire allies, confront threats, and ultimately protect a universe still recovering from the onslaught of the terrible Ur-Quan overlords.<br/><br/>Following in our footsteps from The Ur-Quan Masters and adding modern touches, here’s what you can expect:<br/><br/>*Experience a player-centered space saga. Reveal powerful truths about the universe, and an existential threat that can only be stopped by you.<br/>*Command your starship and navigate a living universe packed with story, danger, and mystery.<br/>*Explore hundreds of star systems and thousands of planets overflowing with life, hazards, and discoveries.<br/>*Befriend (or offend) truly alien aliens that will make you laugh, cry, or be very afraid. Sometimes all three!<br/>*Assemble your combat fleet and control over 30 wildly different starships in unique top-down, arcade-style battles.<br/>*Play with friends online, experiencing the story together in co-op, or fighting it out in competitive Super Melee combat.<br/>*Play the way you want. Decide where to go, who to befriend, and how to confront the cosmic threats you face. There are many ways to succeed!<br/>*Return to the Free Stars universe with the long-awaited sequel to The Ur-Quan Masters, embarking on a fresh adventure for fans both old and new. <br/>")
⏲ 1:36 👁 335K
_rabbit-r1-review-somehow-worse.jpg)
_badhaai-ho-movie---ayushmann-khurrana-sanya-malhotra-neena-gupta-and-gajraj-rao.jpg)
_adorable-toddler-imitates-fourth-grade-aunt-writing-on-paper.jpg)
_rating-swansea-city-and-cardiff-citys-2392-24-championship-campaigns.jpg)
_can-you-get-pregnant-on-your-period-ilana-glazer-and-michelle-buteau-debate.jpg)
_detan-face-pack-hafte-me-kitni-bar-chehre-par-lagana-chahiye-124-boldsky.jpg)
_free-stars-children-of-infinity-is-an-epic-space-action-rpg-and-the-long-awaited-sequel-to-the-ur-quan-masters.jpg)
![[+]](/images/menu.gif){kind=small}